PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 356aa    MW: 39440.3 Da    PI: 6.9298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2051genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
      Gh_D05G2051 14 KGPWSPEEDTKLKAYIEQHGTGgNWIALPHKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.52.6e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd+++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Gh_D05G2051  69 GGFSEEEDKIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.53966IPR017930Myb domain
SuperFamilySSF466891.39E-2611109IPR009057Homeodomain-like
SMARTSM007173.7E-131364IPR001005SANT/Myb domain
PfamPF002491.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-241569IPR009057Homeodomain-like
CDDcd001672.71E-101662No hitNo description
SMARTSM007173.9E-1167115IPR001005SANT/Myb domain
PROSITE profilePS5129415.49167117IPR017930Myb domain
PfamPF002496.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2270115IPR009057Homeodomain-like
CDDcd001672.33E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDTKLKAYIE QHGTGGNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDKIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKILLGK  120
QRKEHQSRRG NSLKQDMKRS SASVGDSMVP ADNINQIPYW PELPVLAAAA APIPHSSQEH  180
RIDSQASMRR LLIKLGGRFS EDDHVVNDGT TLHQFPNDLS TTDQDLYEQT VYVPSSSSSS  240
PMDALSLSNN IGSQFVNSQF AIDGGNLPML QGQSTTFSSE LQEMGYSSNP QRLDGMEFLY  300
GEGMVDNRGV NPCESIGWGD TSSLVGPPCA SEYGVMQQGM LQEYGFSEMR YPGGAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24141157106B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527241e-110KM052724.1 Gossypium hirsutum RAX-like transcription factor RAX5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440648.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLA0A0D2URZ00.0A0A0D2URZ0_G
STRINGVIT_18s0001g08470.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.16e-83myb domain protein 68